PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.F04423.1.p
Common NameEUGRSUZ_F04423, LOC104450998
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 197aa    MW: 22501.2 Da    PI: 9.4637
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.F04423.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.44.4e-201259148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd +l+++++ +G ++WktIa+t g+ R++k+c++rw++yl
  Eucgr.F04423.1.p 12 KGAWTPEEDRKLAEVIAVHGAKRWKTIAATAGLSRCGKSCRLRWLNYL 59
                      79********************************************97 PP

2Myb_DNA-binding52.21.4e-1665110148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg+ T +E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l
  Eucgr.F04423.1.p  65 RGNITDQEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 110
                       7999******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.924759IPR017930Myb domain
SMARTSM007172.0E-141161IPR001005SANT/Myb domain
SuperFamilySSF466891.47E-2911106IPR009057Homeodomain-like
PfamPF002497.9E-181259IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-251366IPR009057Homeodomain-like
CDDcd001678.72E-101459No hitNo description
PROSITE profilePS5129426.11460114IPR017930Myb domain
SMARTSM007179.1E-1664112IPR001005SANT/Myb domain
PfamPF002497.3E-1565110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-2567115IPR009057Homeodomain-like
CDDcd001671.01E-969110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MEKSSAAKEY SKGAWTPEED RKLAEVIAVH GAKRWKTIAA TAGLSRCGKS CRLRWLNYLR  60
PNIKRGNITD QEEDLILRLH KLLGNRWSLI AGRLPGRTDN EIKNYWNSHL SKKIKQKEKQ  120
SEAPKREGKE AQRRRGAERV SVEVREESSS NGGEESKTSV DFDVDEFFDF SNESSLNLEW  180
VSRFLESDKG ICDERS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-2991144108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.F04423.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010064041.11e-141PREDICTED: transcription factor MYB23-like
SwissprotQ962763e-56MYB23_ARATH; Transcription factor MYB23
TrEMBLA0A059BZC11e-141A0A059BZC1_EUCGR; Uncharacterized protein
STRINGVIT_09s0002g01380.t012e-90(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40330.12e-52myb domain protein 23